missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MGMT (aa 3-74) Control Fragment Recombinant Protein

Product Code. 30201497
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201497

Brand: Invitrogen™ RP104643

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

O6-Methylguanine-DNA Methyltransferase (MGMT) is an important DNA repair protein involved in tumor cell resistance to the cytostatic activity of chemotherapeutic alkylating agents. This protein is also effective in protecting normal cells against the genotoxic and carcinogenic effects of DNA alkylation. The alkylating drug resistance is caused by MGMT's ability to remove DNA alkyl groups introduced in the O6 position of guanine. MGMT is expressed in highly variable amounts, depending upon the cell and tissue type, species, and cellular growth characteristics. In addition, MGMT activity varies among groups of tumors and within a particular type of tumor.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P16455
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4255
Name Human MGMT (aa 3-74) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0-6-methylguanine-DNA methyltransferase; 6-O-methylguanine-DNA methyltransferase; Agat; AGT; AI267024; methylated DNA protein cysteine methyltransferase; methylated-DNA--protein-cysteine methyltransferase; methylguanine-DNA methyltransferase; MGMT; O(6)-alkylguanine-DNA alkyltransferase; O-6-alkylguanine-DNA alkyltransferase; O6-alkylguanine-DNA alkyltransferase; O-6-methylguan; O6-methylguanine-DNA methyltranferase; O-6-methylguanine-DNA methyltransferase; O6-methylguanine-DNA methyltransferase; O-6-methylguanine-DNA-alkyltransferase
Common Name MGMT
Gene Symbol MGMT
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.