missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208479

Invitrogen™ Human mGluR6 (aa 458-534) Control Fragment Recombinant Protein

Product Code. 30208479
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208479

Brand: Invitrogen™ RP105730

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutamate receptors constitute the principal excitatory neurotransmitter receptors in brain. Two classes of glutamate receptors exist: Ionotropic receptors, and metabotropic receptors. Ionotropic glutamate receptors are oligomeric complexes of various subunits (GluR17, NMDA13, KAI2), which comprise ligand-gated calcium channels. Metabotropic glutamate receptors are G-protein coupled receptors, which when activated can activate phopholipases or adenylylcyclase, depending on the neuron.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15303
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2916
Name Human mGluR6 (aa 458-534) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC021919; CSNB1B; G protein-coupled receptor GRM6; G protein-coupled receptor, family C, group 1, member F; glutamate metabotropic receptor 6; glutamate receptor; glutamate receptor, metabotropic 6; Gm3; GPRC1F; Grm6; Metabotropic glutamate receptor 6; mGlu6; MGLUR6; nerg1; nob2; nob3; nob4
Common Name mGluR6
Gene Symbol GRM6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VMFNENGDAPGRYDIFQYQATNGSASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.