Invitrogen™ Human MGAT5B (aa 257-393) Control Fragment Recombinant Protein

Product Code. 30196236

Brand: Invitrogen™ RP105719

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64936 (PA5-64936. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glycosyltransferase that acts on alpha-linked mannose of N-glycans and O-mannosyl glycans. Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to the beta 1-6 linkage of the mannose residue of GlcNAcbeta1,2-Manalpha on both the alpha1,3- and alpha1,6-linked mannose arms in the core structure of N-glycan. Also acts on the GlcNAcbeta1,2-Manalpha1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. Plays an active role in modulating integrin and laminin-dependent adhesion and migration of neuronal cells via its activity in the O-mannosyl glycan pathway.

Specifications

• Accession Number: Q3V5L5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 146664
• Name: Human MGAT5B (aa 257-393) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B; alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B; beta(1,6)-N-acetylglucosaminyltransferase V; beta1,6-N-acetylglucosaminyltransferase IX (GnT-IX); C330018B01; GlcNAc-T Vb; GnT-IX; GNT-Vb; hGnTVb; KIAA2008; mannoside acetylglucosaminyltransferase 5, isoenzyme B; mannoside acetylglucosaminyltransferase 5 B; mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isoenzyme B; mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isozyme B; Mgat5b; mGnTVB; N-acetylglucosaminyltranferase VB; N-acetylglucosaminyltransferase IX; N-acetylglucosaminyl-transferase Vb; UDP-N-acetylglucosamine: alpha1,6-D-mannoside beta1,6-N-acetylglucosaminyltransferase b
• Common Name: MGAT5B
• Gene Symbol: MGAT5B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQSNLGVPPGRGSCPLTMPLPFDLIYTDYHGLQQMKRHMGLSFKKYRCRIRVID
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining