Invitrogen™ Human MGAT4B (aa 35-123) Control Fragment Recombinant Protein

Product Code. 30208402

Brand: Invitrogen™ RP101404

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62561 (PA5-62561. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N- linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Has lower affinities for donors or acceptors than MGAT4A, suggesting that, under physiological conditions, it is not the main contributor in N- glycan biosynthesis.

Specifications

• Accession Number: Q9UQ53
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11282
• Name: Human MGAT4B (aa 35-123) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2.4.1.145; alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B; alpha-1,3-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase; aminyltransferase; glcNAc-T IVb; GNT-IV; GNT-IVB; mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isoenzyme B; mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme B; MGAT4B; N-acetylglucosaminyltransferase IVb; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb; UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IV; UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVb; UNQ906/PRO1927
• Common Name: MGAT4B
• Gene Symbol: MGAT4B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining