Invitrogen™ Human MGAT4A (aa 385-517) Control Fragment Recombinant Protein

Product Code. 30198975

Brand: Invitrogen™ RP89705

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52456 (PA5-52456. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme B, catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc in a beta-1,4 linkage to the Man-alpha-1,3-Man-beta-1,4-GlcNAc arm of R-Man-alpha-1,6(GlcNAc-beta-1,2-Man-alpha-1,3)Man-beta-1,4-GlcNAc-beta-1,4-GlcNAc-beta-1-Asn. The encoded protein may play a role in regulating the availability of serum glycoproteins, oncogenesis, and differentiation.

Specifications

• Accession Number: Q9UM21
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11320
• Name: Human MGAT4A (aa 385-517) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2.4.1.145; 9530018I07Rik; alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A; Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A soluble form; alpha-1,3-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase; glcNAc-T IVa; glcNAc-T-IVa; GnT-4 A; GNT-IV; GNT-IVA; mannoside acetylglucosaminyltransferase 4, isoenzyme A; mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isoenzyme A; mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme A; Mgat4a; N-acetylglucosaminyltransferase IVa; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa; UDP-GlcNAc:a-1,3-D-mannoside b-1,4-acetylglucosaminyltransferase IV; UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVa; UDP-N-acetylglucosamine:alpha1,3-d-mannoside beta1,4-N-acetylglucosaminyltransferase
• Common Name: MGAT4A
• Gene Symbol: MGAT4A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining