Invitrogen™ Human MGAT2 (aa 58-153) Control Fragment Recombinant Protein

Product Code. 30181074

Brand: Invitrogen™ RP99888

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60484 (PA5-60484. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in this gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. The coding region of this gene is intronless. Transcript variants with a spliced 5' UTR may exist, but their biological validity has not been determined.

Specifications

• Accession Number: Q10469
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4247
• Name: Human MGAT2 (aa 58-153) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA407964; alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase; Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like protein; beta-1,2-N-acetylglucosaminyltransferase II; beta-12-N-acetylglucosaminyltransferase II; CDG2A; CDGS2; CH73-301C19.1; GlcNAc-T II; GLCNACTII; GNT2; GNT-II; Mannoside acetylglucosaminyltransferase 2; mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase; mgat2; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II; UDP-N-acetylglucosamine:alpha-6-D-mannoside beta-1,2-N-acetylglucosaminyltransferase II; zgc:162268
• Common Name: MGAT2
• Gene Symbol: MGAT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining