missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206370

Invitrogen™ Human MFAP1 (aa 250-387) Control Fragment Recombinant Protein

Product Code. 30206370
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206370

Brand: Invitrogen™ RP90794

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-139758 (PA5-139758, PA5-59958 (PA5-59958. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MFAP1 is a component of the elastin-associated microfibrils. Microfibrils, found either in association with elastin or independently, are an important component of the extracellular matrix of many tissues. MFAP1 is one of a number of proteins demonstrated to be essential for cell division.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P55081
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4236
Name Human MFAP1 (aa 250-387) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4432409M24Rik; Mfap1; Mfap1a; Mfap1b; microfibril associated protein 1; microfibrillar associated protein 1; microfibrillar-associated protein 1; microfibrillar-associated protein 1 A; Microfibrillar-associated protein 1 B; microfibrillar-associated protein 1-like protein; RGD1562232; Spliceosome B complex protein MFAP1; Spliceosome B complex protein MFAP1A; Spliceosome B complex protein MFAP1B
Common Name MFAP1
Gene Symbol MFAP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVMQVKNFGRSG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.