Invitrogen™ Human METTL24 (aa 287-365) Control Fragment Recombinant Protein

Product Code. 30194966

Brand: Invitrogen™ RP94612

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57953 (PA5-57953. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

METTL24 gene ontology annotations related to this gene include methyltransferase activity.

Specifications

• Accession Number: Q5JXM2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 728464
• Name: Human METTL24 (aa 287-365) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9030224M15Rik; C6orf186; C9H6orf186; dJ71D21.2; methyltransferase like 24; methyltransferase-like protein 24; Mettl24; UPF0624 protein C6orf186; UPF0624 protein C6orf186 homolog
• Common Name: METTL24
• Gene Symbol: METTL24
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LEQIGQLIFEIHLHWPGFEVSGSDSSVVRFWYSLLKELEQKDFRLFHSYKDLSKPQLFLKKDIFNASSCYTLSWVNTRW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining