Invitrogen™ Human METTL13 (aa 495-588) Control Fragment Recombinant Protein

Product Code. 30194829

Brand: Invitrogen™ RP103165

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62828 (PA5-62828. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

METTL13 gene ontology annotations related to this gene include methyltransferase activity.

Specifications

• Accession Number: Q8N6R0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51603
• Name: Human METTL13 (aa 495-588) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5630401D24Rik; antiapoptotic protein FEAT; CGI-01; eEF1A lysine and N-terminal methyltransferase; eEF1A lysine methyltransferase; eEF1A N-terminal methyltransferase; EEF1AKNMT; eEF1A-KNMT; feat; KIAA0859; methyltransferase like 13; methyltransferase-like protein 13; METTL13; RGD1311526
• Common Name: METTL13
• Gene Symbol: EEF1AKNMT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQWFGFSQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining