Invitrogen™ Human METTL11B (aa 216-277) Control Fragment Recombinant Protein

Product Code. 30197260

Brand: Invitrogen™ RP94569

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55753 (PA5-55753. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes monomethylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and Pro in the Pro-Pro-Lys motif. May activate NTMT1 by priming its substrates for trimethylation.

Specifications

• Accession Number: Q5VVY1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 149281
• Name: Human METTL11B (aa 216-277) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: alpha N-terminal protein methyltransferase 1 B; C1orf184; Gm207; HOMT1B; methyltransferase like 11 B; methyltransferase-like protein 11 B; METTL11B; NRMT2; NTM1B; RGD1564106; X-Pro-Lys N-terminal protein methyltransferase 1 B
• Common Name: METTL11B
• Gene Symbol: Mettl11b
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GIIILKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPVWMFAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining