Invitrogen™ Human METTL1 (aa 207-276) Control Fragment Recombinant Protein

Product Code. 30200813

Brand: Invitrogen™ RP92501

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54280 (PA5-54280. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.

Specifications

• Accession Number: Q9UBP6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4234
• Name: Human METTL1 (aa 207-276) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810012D02Rik; C12orf1; D1075-like gene product; hypothetical protein LOC449779; methyltransferase like 1; methyltransferase-like 1; methyltransferase-like protein 1; METTL1; miRNA (guanine-N(7)-)-methyltransferase; mRNA (guanine-N(7)-)-methyltransferase; TRM8; TRMT8; tRNA (guanine(46)-N(7))-methyltransferase; tRNA (guanine-N(7)-)-methyltransferase; tRNA (guanine-N(7)-)-methyltransferase-like protein; tRNA(m7G46)-methyltransferase; Unknown (protein for MGC:134433); YDL201w; zgc:103636
• Common Name: METTL1
• Gene Symbol: Mettl1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining