Invitrogen™ Human METT10D (aa 41-141) Control Fragment Recombinant Protein

Product Code. 30212764

Brand: Invitrogen™ RP105140

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66279 (PA5-66279. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

METT10D is a probable methyltransferase.

Specifications

• Accession Number: Q86W50
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79066
• Name: Human METT10D (aa 41-141) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610100D03Rik; 2810013M15Rik; A830095F14Rik; AI846133; methyltransferase 10 domain containing; methyltransferase 10 domain-containing protein; methyltransferase like 16; methyltransferase-like protein 16; METT10D; METTL16; N6-adenosine-methyltransferase METTL16; putative methyltransferase METT10D; RNA N6-adenosine-methyltransferase METTL16; U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
• Common Name: METT10D
• Gene Symbol: METTL16
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RVSLNFKDPEAVRALTCTLLREDFGLSIDIPLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining