Invitrogen™ Human MEKK3 (aa 3-85) Control Fragment Recombinant Protein

Artikelnummer. 30202015

missing translation for 'mfr': Invitrogen™ RP97252

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP3K3 (MEKK3) directly regulates MAPK8 and extracellular signal-regulated protein kinase (ERK) pathways by phosphorylating multiple MAP2Ks. Northern blot analysis revealed a 4. 6-kb transcript that appears to be ubiquitously expressed. This protein directly regulates the stress-activated protein kinase (SAPK) and extracellular signal-regulated protein kinase (ERK) pathways by activating SEK and MEK1/2 respectively; it does not regulate the p38 pathway. In cotransfection assays, it enhanced transcription from a nuclear factor kappa-B (NFKB)-dependent reporter gene, consistent with a role in the SAPK pathway. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Spezifikation

• Accession Number: Q99759
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4215
• Name: Human MEKK3 (aa 3-85) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW548911; MAP/ERK kinase kinase 3; MAP3K3; MAPK/ERK kinase kinase 3; MAPKKK3; MEK kinase 3; MEKK 3; Mekk3; mitogen activated protein kinase kinase kinase 3; mitogen-activated protein kinase kinase kinase 3; mKIAA4031
• Common Name: MEKK3
• Gene Symbol: Map3k3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSALLNSPTVTTSSCAGASEKKKFLSDVRIKFEHNGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining