Invitrogen™ Human MEKK2 (aa 74-200) Control Fragment Recombinant Protein

Product Code. 30202820

Brand: Invitrogen™ RP102059

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54443 (PA5-54443. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP3K2 (MEKK2) is a serine/threonine kinase that activates kinases involved in the MAP kinase signaling pathway. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process.

Specifications

• Accession Number: Q9Y2U5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10746
• Name: Human MEKK2 (aa 74-200) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2.7.11.25; 9630061B06Rik; AI585793; MAP/ERK kinase kinase 2; MAP3K2; MAPK/ERK kinase kinase 2; MAPKKK2; MEK kinase 2; MEKK 2; MEKK2; MEKK2B; mitogen activated protein kinase kinase kinase 2; mitogen-activated protein kinase kinase kinase 2; protein kinase MEKK2b
• Common Name: MEKK2
• Gene Symbol: Map3k2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPESMDQM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining