Invitrogen™ Human MEK6 (aa 2-61) Control Fragment Recombinant Protein

Product Code. 30196342

Brand: Invitrogen™ RP95063

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MKK6 (MEK6, MAP2K6) is a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. Tissue specificity: Isoform 2 is only expressed in skeletal muscle. Isoform 1, on the other hand, is found in skeletal muscle, heart, and in lesser extent in liver or pancreas.

Specifications

• Accession Number: P52564
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5608
• Name: Human MEK6 (aa 2-61) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Dual specificity mitogen-activated protein kinase kinase 6; MAP kinase kinase 6; MAP2K6; MAPK/ERK kinase 3; MAPK/ERK kinase 6; MAPKK 3; MAPKK 6; MAPKK3; MAPKK6; MEK 3; MEK 6; MEK3; MEK6; mitogen activated protein kinase kinase 6; mitogen-activated protein kinase kinase 6; MKK3; MKK6; PRKMK3; Prkmk6; protein kinase, mitogen activated, kinase 6; protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6); SAPK kinase 2; SAPK kinase 3; SAPKK2; SAPKK-2; SAPKK3; SAPKK-3; SKK3; Stress-activated protein kinase kinase 3
• Common Name: MEK6
• Gene Symbol: MAP2K6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining