missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MEK6 (aa 2-61) Control Fragment Recombinant Protein

Product Code. 30196342
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196342

Brand: Invitrogen™ RP95063

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MKK6 (MEK6, MAP2K6) is a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. Tissue specificity: Isoform 2 is only expressed in skeletal muscle. Isoform 1, on the other hand, is found in skeletal muscle, heart, and in lesser extent in liver or pancreas.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P52564
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5608
Name Human MEK6 (aa 2-61) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Dual specificity mitogen-activated protein kinase kinase 6; MAP kinase kinase 6; MAP2K6; MAPK/ERK kinase 3; MAPK/ERK kinase 6; MAPKK 3; MAPKK 6; MAPKK3; MAPKK6; MEK 3; MEK 6; MEK3; MEK6; mitogen activated protein kinase kinase 6; mitogen-activated protein kinase kinase 6; MKK3; MKK6; PRKMK3; Prkmk6; protein kinase, mitogen activated, kinase 6; protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6); SAPK kinase 2; SAPK kinase 3; SAPKK2; SAPKK-2; SAPKK3; SAPKK-3; SKK3; Stress-activated protein kinase kinase 3
Common Name MEK6
Gene Symbol MAP2K6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.