Invitrogen™ Human MEI1 (aa 588-670) Control Fragment Recombinant Protein

Product Code. 30211366

Brand: Invitrogen™ RP95369

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61916 (PA5-61916. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The predominant cause of spermatogenic arrest of meiosis is the failure of homologous chromosomes to accurately synapse. MEI1 (Meiosis inhibitor protein 1), also designated Meiosis defective protein 1, is a 1274 amino acid protein that is likely required for the formation of genetically programmed double-strand breaks, the first step in the initiation of meiosis. With predominant expression in testis, it is likely that defects of the gene encoding MEI1 results in male infertility. Interestingly, studies show that genetic variation in the MEI gene possibly predisposes European Americans but not Israeli men to infertility by meiotic arrest. Human MEI1 shares 79% sequence similarity with its mouse homolog. There are seven isoforms of MEI1 that are produced as a result of alternative splicing events.

Specifications

• Accession Number: Q5TIA1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 150365
• Name: Human MEI1 (aa 588-670) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4932408F18Rik; MEI1; meiosis defective 1; meiosis defective protein 1; meiosis inhibitor 1; meiosis inhibitor protein 1; meiotic double-stranded break formation protein 1; SPATA38; spermatogenesis associated 38
• Common Name: MEI1
• Gene Symbol: MEI1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HMKEKFSKKLASSSFIRLTLELKARFCSGLSHSALNQVCSNFLYYMCLNLLSAPEKTGPPSKEELSAVSELLQHGLPQISSRS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining