missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210092

Invitrogen™ Human MEF2A (aa 346-406) Control Fragment Recombinant Protein

Product Code. 30210092
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210092

Brand: Invitrogen™ RP106129

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The proteins belonging to structural maintenance of chromosomes (SMC) family play critical roles in chromosome structural changes. SMC proteins are involved in the proper condensation and segregation of mitotic chromosomes. Four human SMC proteins that form two distinct heterodimeric complexes in the cell, the human chromosome-associated protein (hCAP)-C and hCAP-E protein complex (hCAP-C/hCAP-E), and the human SMC1 (hSMC1) and hSMC3 protein complex (hSMC1/hSMC3) have been identified.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q02078
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4205
Name Human MEF2A (aa 346-406) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A430079H05Rik; ADCAD1; C5DELq14.3; DEL5q14.3; MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancer factor 2 A); MADS box transcription enhancer factor 2, polypeptide C; mef2; Mef2a; MEF2C; myocyte enhancer factor 2 A; myocyte enhancer factor 2 C; Myocyte-specific enhancer factor 2 A; myocyte-specific enhancer factor 2 C; RSRFC4; RSRFC9; Serum response factor-like protein 1
Common Name MEF2A
Gene Symbol MEF2A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.