missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195790

Invitrogen™ Human MED4 (aa 6-120) Control Fragment Recombinant Protein

Product Code. 30195790
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195790

Brand: Invitrogen™ RP89352

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82240 (PA5-82240. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Mediator is a multiprotein coactivator that is required by DNA-binding transcription factors for activation of polymerase II transcribed genes. MED4 appears to be a core Mediator subunit and is found in nearly all Mediator preparations (Sato et al., 2004).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NPJ6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29079
Name Human MED4 (aa 6-120) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2410046H15Rik; Activator-recruited cofactor 36 kDa component; ARC36; DRIP36; FLJ10956; HSPC126; hypothetical protein LOC550582; LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 4; MED4; Mediator complex subunit 4; mediator of RNA polymerase II transcription subunit 4; mediator of RNA polymerase II transcription, subunit 4 homolog; mediator, 34-kD subunit, homolog; p36 TRAP/SMCC/PC2 subunit; RP11-90M2.2; TRAP/SMCC/PC2 subunit p36; TRAP/SMCC/PC2 subunit p36 subunit; TRAP36; Vdirp; Vdrip; vitamin D receptor interacting protein; vitamin D receptor-interacting protein, 36-kD; vitamin D3 receptor-interacting protein complex 36 kDa component; zgc:110646
Common Name MED4
Gene Symbol MED4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.