Invitrogen™ Human MED31 (aa 2-72) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP96552

Product Code. 30196667

Description

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57477 (PA5-57477. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.

Specifications

• Accession Number: Q9Y3C7
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 51003
• Quantity: 100 μL
• Gene Alias: 3110004H13Rik; CGI-125; fa04d01; FLJ27436; FLJ36714; hSOH1; l11Jus15; med31; Mediator complex subunit 31; mediator complex subunit soh1; Mediator of RNA polymerase II transcription subunit 31; mediator of RNA polymerase II transcription subunit 31; LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 31; mediator of RNA polymerase II transcription, subunit 31 homolog; RGD1309457; soh1; wu:fa04d01; zgc:92673
• Gene Symbol: MED31
• Species: Human
• Protein Tag: His-ABP-tag
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Form: Liquid

• Concentration: ≥5.0 mg/mL
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Name: Human MED31 (aa 2-72) Control Fragment
• Regulatory Status: RUO
• Common Name: MED31
• Conjugate: Unconjugated
• Recombinant: Recombinant
• Sequence: AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQC
• Expression System: E. coli
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining