Invitrogen™ Human MED29 (aa 116-183) Control Fragment Recombinant Protein

Product Code. 30195231

Brand: Invitrogen™ RP106673

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65990 (PA5-65990. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In mammalian cells, transcription is regulated in part by high molecular weight co-activating complexes that mediate signals between transcriptional activators and RNA polymerase II (Pol II). The mediator complex is one such multi-protein structure that functions as a bridge between regulatory proteins and Pol II, thereby regulating Pol II-dependent transcription. Med29 (mediator complex subunit 29), also known as IXL (intersex-like), is a 200 amino acid nuclear protein and component of the mediator complex. Widely expressed in embryo and adult tissue, Med29 is considered a novel amplification target gene in pancreatic cancer and is encoded by a gene that maps to human chromosome 19q13.2. Chromosome 19 consists of over 63 million bases, houses approximately 1,400 genes and is recognized for having the greatest gene density of the human chromosomes.

Specifications

• Accession Number: Q9NX70
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55588
• Name: Human MED29 (aa 116-183) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810405O22Rik; AU020902; chunp6869; DKFZp434H247-like protein; intersex-like protein; ixl; ixl protein; MED2; MED29; Mediator complex subunit 29; mediator of RNA polymerase II transcription subunit 29; RGD1311009; similar to Homo sapiens DKFZp434H247 protein; zgc:109789
• Common Name: MED29
• Gene Symbol: MED29
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCAN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining