Invitrogen™ Human MED28 (aa 110-178) Control Fragment Recombinant Protein

Product Code. 30195973

Brand: Invitrogen™ RP96636

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57455 (PA5-57455. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mediator complex is a multi-protein transcriptional co-activator that is expressed ubiquitously in eukaryotes from yeast to mammals and is required for induction of RNA polymerase II (pol II) transcription by DNA binding transcription factor. One of the proteins in this complex is MED28, also known as Magicin. MED28 is expressed in many cell lines and tissues. It has been shown that a down-regulation of MED28 expression in NIH3T3 cells results in a significant induction of several genes associated with smooth muscle cell differentiation and conversely its over-expression represses expression of SMC genes. MED28 can also form a ternary complex with Grb2 and Merlin, the neurofibromatosis 2 tumor suppressor protein, indicating that MED28 may play a role in Merlin's tumor suppressive activity. MED28 has also been recently identified as an HIV dependency factor (HDF), suggesting that MED28 may be an important drug target in HIV treatment. At least two isoforms of MED28 are known to exist.

Specifications

• Accession Number: Q9H204
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80306
• Name: Human MED28 (aa 110-178) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500003D12Rik; AI451633; AU045690; EG1; endothelial-derived; endothelial-derived gene 1; endothelial-derived protein 1; Fksg20; Magicin; Med28; Mediator complex subunit 28; mediator of RNA polymerase II transcription subunit 28; mediator of RNA polymerase II transcription, subunit 28 homolog; merlin and Grb2-interacting cytoskeletal protein; RGD1305875; Tumor angiogenesis marker EG-1
• Common Name: MED28
• Gene Symbol: MED28
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining