Invitrogen™ Human MED27 (aa 79-171) Control Fragment Recombinant Protein

Product Code. 30201026

Brand: Invitrogen™ RP89375

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52374 (PA5-52374. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

Specifications

• Accession Number: Q6P2C8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9442
• Name: Human MED27 (aa 79-171) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500015J03Rik; 2310042P07Rik; AA682045; cofactor required for Sp1 transcriptional activation subunit 8; cofactor required for Sp1 transcriptional activation, subunit 8; cofactor required for Sp1 transcriptional activation, subunit 8, 34 kDa; CRAP34; CRSP complex subunit 8; CRSP34; CRSP8; D2Ertd434e; LOC525389 protein; MED27; MED3; mediator complex subunit 27; Mediator of RNA polymerase II transcription subunit 27; MGC11274; p37 TRAP/SMCC/PC2 subunit; RGD1564993; transcriptional coactivator CRSP34; transcriptional co-activator CRSP8 homolog; TRAP37
• Common Name: MED27
• Gene Symbol: MED27
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining