Invitrogen™ Human MED26 (aa 306-377) Control Fragment Recombinant Protein

Product Code. 30210960

Brand: Invitrogen™ RP107839

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67203 (PA5-67203. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone.

Specifications

• Accession Number: O95402
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9441
• Name: Human MED26 (aa 306-377) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730493L18Rik; Activator-recruited cofactor 70 kDa component; AI414941; ARC70; AW495270; cofactor required for Sp1 transcriptional activation subunit 7; cofactor required for Sp1 transcriptional activation, subunit 7 (70 kD); cofactor required for Sp1 transcriptional activation, subunit 7, 70 kDa; CRSP complex subunit 7; Crsp7; CRSP70; Med26; Mediator complex subunit 26; mediator of RNA polymerase II transcription subunit 26; Slc35e1; solute carrier family 35, member E1; transcriptional coactivator CRSP70
• Common Name: MED26
• Gene Symbol: MED26
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGLSPAEPLLSRAGFSPDSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining