Invitrogen™ Human MED19 (aa 52-120) Control Fragment Recombinant Protein

Product Code. 30212463

Brand: Invitrogen™ RP97401

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59329 (PA5-59329. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II.

Specifications

• Accession Number: A0JLT2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 219541
• Name: Human MED19 (aa 52-120) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410018M14Rik; 3110040A13Rik; DT2P1G7; LCMR1; Lung cancer metastasis-related protein 1; Med19; MED19AS; mediator complex subunit 19; Mediator of RNA polymerase II transcription subunit 19; mediator of RNA polymerase II transcription, subunit 19 homolog; putative mediator subunit MED19AS protein; RGD1311926
• Common Name: MED19
• Gene Symbol: MED19
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining