Invitrogen™ Human MED14 (aa 1348-1427) Control Fragment Recombinant Protein

Product Code. 30197095

Brand: Invitrogen™ RP107314

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66666 (PA5-66666. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.

Specifications

• Accession Number: O60244
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9282
• Name: Human MED14 (aa 1348-1427) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9930001L01Rik; Activator-recruited cofactor 150 kDa component; ARC150; AU041628; Cofactor required for Sp1 transcriptional activation subunit 2; cofactor required for Sp1 transcriptional activation subunit 2 (150 kDa); cofactor required for Sp1 transcriptional activation, subunit 2; cofactor required for Sp1 transcriptional activation, subunit 2 (150 kD); CRSP complex subunit 2; CRSP150; CRSP2; CSRP; CXorf4; DRIP150; ENSMUSG00000073278; EXLM1; Gm641; hRGR1; human homolog of yeast RGR1; MED14; Mediator complex subunit 14; mediator of RNA polymerase II transcription subunit 14; MGC104513; ORF1; RGD1560170; RGR1; RGR1 homolog; thyroid hormone receptor-associated protein complex 170 kDa component; thyroid hormone receptor-associated protein complex component TRAP170; Transcriptional coactivator CRSP150; transcriptional co-activator CRSP150; TRAP170; vitamin D receptor-interacting protein complex component DRIP150; vitamin D3 receptor-interacting protein complex 150 kDa component
• Common Name: MED14
• Gene Symbol: Med14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining