missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MED14 (aa 1348-1427) Control Fragment Recombinant Protein

Product Code. 30197095
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197095

Brand: Invitrogen™ RP107314

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66666 (PA5-66666. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60244
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9282
Name Human MED14 (aa 1348-1427) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9930001L01Rik; Activator-recruited cofactor 150 kDa component; ARC150; AU041628; Cofactor required for Sp1 transcriptional activation subunit 2; cofactor required for Sp1 transcriptional activation subunit 2 (150 kDa); cofactor required for Sp1 transcriptional activation, subunit 2; cofactor required for Sp1 transcriptional activation, subunit 2 (150 kD); CRSP complex subunit 2; CRSP150; CRSP2; CSRP; CXorf4; DRIP150; ENSMUSG00000073278; EXLM1; Gm641; hRGR1; human homolog of yeast RGR1; MED14; Mediator complex subunit 14; mediator of RNA polymerase II transcription subunit 14; MGC104513; ORF1; RGD1560170; RGR1; RGR1 homolog; thyroid hormone receptor-associated protein complex 170 kDa component; thyroid hormone receptor-associated protein complex component TRAP170; Transcriptional coactivator CRSP150; transcriptional co-activator CRSP150; TRAP170; vitamin D receptor-interacting protein complex component DRIP150; vitamin D3 receptor-interacting protein complex 150 kDa component
Common Name MED14
Gene Symbol Med14
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.