Invitrogen™ Human MED12 (aa 1878-2015) Control Fragment Recombinant Protein

Product Code. 30196531

Brand: Invitrogen™ RP92262

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51852 (PA5-51852. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The initiation of transcription is controlled in part by a large protein assembly known as the preinitiation complex. A component of this preinitiation complex is a 1.2 MDa protein aggregate called Mediator. This Mediator component binds with a CDK8 subcomplex which contains the protein encoded by this gene, mediator complex subunit 12 (MED12), along with MED13, CDK8 kinase, and cyclin C.

Specifications

• Accession Number: Q93074
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9968
• Name: Human MED12 (aa 1878-2015) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 230 kDa; activator-recruited cofactor 240 kDa component; ARC240; CAG repeat protein 45; CAGH45; FGS1; HOPA; human opposite paired; Kiaa0192; Med12; MED12S; Mediator complex subunit 12; mediator of RNA polymerase II transcription subunit 12; mediator of RNA polymerase II transcription, subunit 12 homolog; Mopa; OHDOX; OKS; OPA1; OPA-1; OPA-containing protein; OPA-containing protein 1; putative mediator subunit 12; thyroid hormone receptor-associated protein complex 230 kDa component; thyroid hormone receptor-associated protein, 230 kDa subunit; TNRC11; TRAP230; trinucleotide repeat containing 11 (THR-associated protein); trinucleotide repeat containing 11 (THR-associated protein, 230 kDa subunit); trinucleotide repeat-containing gene 11 protein
• Common Name: MED12
• Gene Symbol: Med12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPTTMTGVMGLEPSSYKTSVYRQQQPAVPQGQRLRQQLQAKIQSQGMLGQSSVHQMTPSSSYGLQTSQGYTPYVSHVGLQQHTGPAGTMVPPSYSSQPYQSTHPSTNPTLVDPTRHLQQRPSGYVHQQAPTYGHGLTS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining