Invitrogen™ Human ME2 (aa 456-581) Control Fragment Recombinant Protein

Product Code. 30196395

Brand: Invitrogen™ RP88955

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52537 (PA5-52537. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ME2 encodes a mitochondrial NAD-dependent malic enzyme, a homotetrameric protein, that catalyzes the oxidative decarboxylation of malate to pyruvate. It had previously been weakly linked to a syndrome known as Friedreich ataxia that has since been shown to be the result of mutation in a completely different gene. Certain single-nucleotide polymorphism haplotypes of this gene have been shown to increase the risk for idiopathic generalized epilepsy. Alternatively spliced transcript variants encoding different isoforms found for this gene.

Specifications

• Accession Number: P23368
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4200
• Name: Human ME2 (aa 456-581) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW120568; D030040L20Rik; malate dehydrogenase; malate dehydrogenase (oxaloacetate-decarboxylating); malic enzyme 2; malic enzyme 2, NAD(+)-dependent, mitochondrial; Me2; NAD-dependent malic enzyme, mitochondrial; NAD-ME; ODS1; pyruvic-malic carboxylase
• Common Name: ME2
• Gene Symbol: Me2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining