Invitrogen™ Human MDH1 (aa 13-84) Control Fragment Recombinant Protein

Product Code. 30207868

Brand: Invitrogen™ RP95092

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55573 (PA5-55573. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.

Specifications

• Accession Number: P40925
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4190
• Name: Human MDH1 (aa 13-84) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B230377B03Rik; Cytosolic malate dehydrogenase; D17921; Diiodophenylpyruvate reductase; epididymis secretory protein Li 32; HEL-S-32; malate dehydrogenase (EC 1.1.1.37); malate dehydrogenase 1; malate dehydrogenase 1, NAD (soluble); malate dehydrogenase, cytoplasmic; malate dehydrogenase, cytoplasmic; malate dehydrogenase, peroxisomal; malate dehydrogenase, soluble; Malate dehydrogenase-like enzyme; Mdh; Mdh1; MDHA; Mdhl; MDH-s; MDL1; MGC:1375; Mor2; Mor-2; soluble malate dehydrogenase
• Common Name: MDH1
• Gene Symbol: MDH1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining