Invitrogen™ Human MDGA2 (aa 530-665) Control Fragment Recombinant Protein

Product Code. 30194112

Brand: Invitrogen™ RP89091

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51820 (PA5-51820. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MDGA2 may involved in cell-cell interactions.

Specifications

• Accession Number: Q7Z553
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 161357
• Name: Human MDGA2 (aa 530-665) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6720489L24Rik; 9330209L04Rik; acrodysplasia; Adp; c14_5286; MAM domain containing 1; MAM domain containing glycosylphosphatidylinositol anchor 2; MAM domain-containing glycosylphosphatidylinositol anchor protein 2; MAM domain-containing protein 1; MAMDC1; Mdga2; UNQ8188/PRO23197
• Common Name: MDGA2
• Gene Symbol: MDGA2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALVQLIVQYPPAVEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYAVKSLSNENYGVYNCSIINEAGAGRCSFLVTGKAYAPEFYYDTYNPVWQNRHRVYSYSLQWTQMNPDAV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining