Invitrogen™ Human MCPH1 (aa 555-701) Control Fragment Recombinant Protein

Product Code. 30207312

Brand: Invitrogen™ RP89875

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52535 (PA5-52535. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein is implicated in chromosome condensation and DNA damage induced cellular responses, and may play a role in neurogenesis and regulation of the size of the cerebral cortex.

Specifications

• Accession Number: Q8NEM0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79648
• Name: Human MCPH1 (aa 555-701) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5430437K10Rik; BRCT-repeat inhibitor of TERT expression 1; BRIT 1; BRIT1; D030046N04Rik; FLJ12847; Mcph1; MCT; Microcephalin; microcephalin 1; microcephaly, primary autosomal recessive 1; RGD1560642; truncated microcephalin
• Common Name: MCPH1
• Gene Symbol: MCPH1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDLIKPHEELKKSGRGKKPTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining