Invitrogen™ Human MCM4 (aa 70-185) Control Fragment Recombinant Protein

Product Code. 30205793

Brand: Invitrogen™ RP104624

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65088 (PA5-65088. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported.

Specifications

• Accession Number: P33991
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4173
• Name: Human MCM4 (aa 70-185) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 19 G; AI325074; AU045576; cb1025; Cdc21; CDC21 homolog; CDC54; DNA replication licensing factor MCM4; fc12c09; fj85g09; hCdc21; hm:zeh1616; homolog of S. pombe cell devision cycle 21; mcdc21; MCM4; MCM4 minichromosome maintenance deficient 4; MCM4 minichromosome maintenance deficient 4, mitotin; mcm4 protein; Mcmd4; mini chromosome maintenance deficient 4 homolog; minichromosome maintenance complex component 4; minichromosome maintenance deficient 4; minichromosome maintenance deficient 4 homolog; minichromosome maintenance deficient 4 homolog (S. cerevisiae); mKIAA4003; NKCD; NKGCD; P1-CDC21; Unknown (protein for MGC:140484); wu:fc12c09; wu:fj85g09; zeh1616
• Common Name: MCM4
• Gene Symbol: Mcm4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining