Invitrogen™ Human MCM3 (aa 90-228) Control Fragment Recombinant Protein

Product Code. 30195825

Brand: Invitrogen™ RP102498

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52105 (PA5-52105. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.

Specifications

• Accession Number: P25205
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4172
• Name: Human MCM3 (aa 90-228) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL033361; C80350; cervical cancer proto-oncogene 5; DNA polymerase alpha holoenzyme-associated protein P1; DNA replication factor MCM3; DNA replication licensing factor MCM3; HCC5; hRlf beta subunit; MCM3; MCM3 minichromosome maintenance deficient 3; Mcmd; Mcmd3; MGC1157; mini chromosome maintenance deficient; minichromosome maintenance complex component 3; minichromosome maintenance deficient 3; minichromosome maintenance deficient 3 (S. cerevisiae); P1; P1.h; p1.m; p102; P1-MCM3; replication licensing factor, beta subunit; RLF subunit beta; RLFB; RP1-108C2.3
• Common Name: MCM3
• Gene Symbol: MCM3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining