Invitrogen™ Human MCM10 (aa 286-360) Control Fragment Recombinant Protein

Product Code. 30197887

Brand: Invitrogen™ RP105551

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67218 (PA5-67218. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre-RC) and it may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein can interact with MCM2 and MCM6, as well as with the origin recognition protein ORC2. It is regulated by proteolysis and phosphorylation in a cell cycle-dependent manner. Studies of a similar protein in Xenopus suggest that the chromatin binding of this protein at the onset of DNA replication is after pre-RC assembly and before origin unwinding. Alternatively spliced transcript variants encoding distinct isoforms have been identified.

Specifications

• Accession Number: Q7L590
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55388
• Name: Human MCM10 (aa 286-360) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410041F14Rik; AU018508; C330019M07Rik; C79164; CNA43; DNA43; homolog of yeast MCM10; hsMCM10; Mcm10; MCM10 minichromosome maintenance deficient 10; MGC126776; minichromosome maintenance 10 replication initiation factor; minichromosome maintenance complex component 10; minichromosome maintenance deficient 10; minichromosome maintenance deficient 10 (S. cerevisiae); PRO2249; Protein MCM10 homolog
• Common Name: MCM10
• Gene Symbol: MCM10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: REKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTVVGILNANPMK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining