Invitrogen™ Human MCCC1 (aa 350-493) Control Fragment Recombinant Protein

Product Code. 30199422

Brand: Invitrogen™ RP88729

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52542 (PA5-52542. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MCCC1 is the large subunit of3-methylcrotonyl-CoA carboxylase. This enzyme functions as aheterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoAto form 3-methylglutaconyl-CoA.

Specifications

• Accession Number: Q96RQ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56922
• Name: Human MCCC1 (aa 350-493) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810045E08Rik; 2310058B18Rik; 3-methylcrotonyl-CoA carboxylase 1; 3-methylcrotonyl-CoA carboxylase 1 {ECO:0000250; 3-methylcrotonyl-CoA carboxylase biotin-containing subunit; 3-methylcrotonyl-CoA carboxylase biotin-containing subunit {ECO:0000250; 3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha; 3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha {ECO:0000250; EMBL:AAH88473.1, ECO:0000312; Mcca; MCCalpha; MCCase subunit alpha; MCCase subunit alpha {ECO:0000250; MCC-B; MCCC1; mccc1 {ECO:0000312; methylcrotonoyl-CoA carboxylase 1; methylcrotonoyl-CoA carboxylase 1 (alpha); methylcrotonoyl-CoA carboxylase alpha; methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial {ECO:0000250; methylcrotonoyl-Coenzy; methylcrotonoyl-Coenzyme A carboxylase 1 (alpha); R75106; RGD:1310615}; UniProtKB:Q96RQ3}
• Common Name: MCCC1
• Gene Symbol: MCCC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ITGTDLVEWQLRIAAGEKIPLSQEEITLQGHAFEARIYAEDPSNNFMPVAGPLVHLSTPRADPSTRIETGVRQGDEVSVHYDPMIAKLVVWAADRQAALTKLRYSLRQYNIVGLHTNIDFLLNLSGHPEFEAGNVHTDFIPQHH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining