Invitrogen™ Human MC4R (aa 1-44) Control Fragment Recombinant Protein

Product Code. 30193870

Brand: Invitrogen™ RP90873

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Expression of MC4R has been reported in brain. Unlike the other melanocortin receptors, MC4R is not expressed in adrenal cortex or in melanocytes. G-protein Coupled Receptors (GPCRs) comprise one of the largest families of signaling molecules with more than a thousand members currently predicted to exist. All GPCRs share a structural motif consisting of seven membrane-spanning helices, and exist in both active and inactive forms. An array of activating ligands participate in the conformation of GPCRs which leads to signaling via G-proteins and downstream effectors. Ongoing studies have also shown the vast series of reactions which participate in the negative regulation of GPCRs. This 'turn-off' activity has tremendous implications for the physiological action of the cell, and continues to drive pharmacological research for new drug candidates. Two blockbuster drugs which have been developed as GPCR-targeted pharmaceuticals are Zyprexa (Eli Lilly) and Claritin (Schering-Plough) which have multi-billion dollar shares of the mental health and allergy markets, respectively.

Specifications

• Accession Number: P32245
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4160
• Name: Human MC4R (aa 1-44) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: MC4; MC4 receptor; mc4r; Mc4-r; melanocortin 4 receptor; melanocortin receptor 4; si:dkey-151m6.62; zMC4
• Common Name: MC4R
• Gene Symbol: MC4R
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining