Invitrogen™ Human MBIP (aa 187-312) Control Fragment Recombinant Protein

Product Code. 30201736

Brand: Invitrogen™ RP89095

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82087 (PA5-82087. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MBIP inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.

Specifications

• Accession Number: Q9NS73
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51562
• Name: Human MBIP (aa 187-312) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933408E06Rik; BM-015; MAP3K12 binding inhibitory protein 1; MAP3K12-binding inhibitory protein 1; MAPK upstream kinase-binding inhibitory protein; MBIP; MUK-binding inhibitory protein; Unknown (protein for MGC:143421)
• Common Name: MBIP
• Gene Symbol: MBIP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DCNQENSCARTDAIFTPYPGFKSHVKVSRVVNTYGPQTRPEGIPGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVSFSGKRRKVQPPQQNY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining