Invitrogen™ Human MASTL (aa 415-508) Control Fragment Recombinant Protein

Product Code. 30193936

Brand: Invitrogen™ RP95202

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82955 (PA5-82955. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MASTL or microtubule associated serine/threonine kinase-like belongs to the MAST family, AGC Ser/Thr protein kinase group. MASTL promotes mitotic progression and cell cycle reentry after DNA damage. Loss of MASTL leads to defects in chromosome condensation, separation, and other aspects of mitotic progression, which is primarily mediated by inhibiting PP2A/B55 delta. Overexpression of MASTL is correlated with cancer progression, poor patient survival, and tumor recurrence in various cancers. Mutations at this locus have been associated with autosomal dominant thrombocytopenia, also known as thrombocytopenia-2. Alternatively spliced transcript variants have been described for this locus.

Specifications

• Accession Number: Q96GX5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84930
• Name: Human MASTL (aa 415-508) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700091H24Rik; C88295; GREATWALL; greatwall kinase homolog; greatwall protein kinase; GW; GWL; hGWL; Mastl; MAST-L; microtubule associated serine/threonine kinase like; microtubule associated serine/threonine kinase-like; microtubule-associated serine/threonine-protein kinase-like; RP11-85G18.2; Serine/threonine-protein kinase greatwall; THC2
• Common Name: MASTL
• Gene Symbol: MASTL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TSQLGFHQSNQWAVDSGGISEEHLGKRSLKRNFELVDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQNTGLTVEVQDLKLSVHKSQQNDCANKEN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining