Invitrogen™ Human MAST2 (aa 1539-1606) Control Fragment Recombinant Protein

Product Code. 30180522

Brand: Invitrogen™ RP98307

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58900 (PA5-58900. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Syntrophin is an adapter protein that functions to bind certain signaling molecules to the dystrophin-associated protein complex. This complex connects the extracellular matrix to the intracellular cytoskeleton for construction and maintenance of the postsynaptic structures in the neuromuscular junction and the central nervous system. Microtubule-associated serine/threonine-protein kinase 2 (MAST205) is a testis-specific, cytoplasmic protein that functions in a multi-protein complex in the maturation of spermatids. MAST205 is involved in linking the dystrophin/utrophin network with microtubule filaments via Syntrophin. By forming a complex with TRAF6, MAST205 regulates lipopolysaccharide-induced IL-12 synthesis in macrophages. This leads to the inhibition of TRAF6 NF-kappa-B activation. Two isoforms exist for MAST205 due to alternative splicing. Isoform 1 represents the full length protein, while isoform 2 lacks the residues 327-396 and 1091-1113. The N-terminus of MAST205 must be phosphorylated in order for ubiquitination to occur at the same site. This ubiquitination leads to the degradation of MAST205 via proteasome-mediated proteolysis.

Specifications

• Accession Number: Q6P0Q8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23139
• Name: Human MAST2 (aa 1539-1606) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KIAA0807; Mast2; MAST205; microtubule associated serine/threonine kinase 2; microtubule associated testis specific serine/threonine protein kinase; microtubule-associated serine/threonine-protein kinase 2; Mtssk
• Common Name: MAST2
• Gene Symbol: MAST2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GESGEEDPFPSRDPRSLGPMVPSLLTGITLGPPRMESPSGPHRRLGSPQAIEEAASSSSAGPNLGQSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining