Invitrogen™ Human Mast Cell Chymase (aa 150-203) Control Fragment Recombinant Protein

Product Code. 30209764

Brand: Invitrogen™ RP101142

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84117 (PA5-84117. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product is a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Angiotensin II has been implicated in blood pressure control and in the pathogenesis of hypertension, cardiac hypertrophy, and heart failure. Thus, this gene product is a target for cardiovascular disease therapies. This gene maps to 14q11. 2 in a cluster of genes encoding other proteases.

Specifications

• Accession Number: P23946
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1215
• Name: Human Mast Cell Chymase (aa 150-203) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: alpha-chymase; Chymase; chymase 1; chymase 1 preproprotein transcript E; chymase 1 preproprotein transcript I; chymase 1, mast cell; chymase, heart; chymase, mast cell; CMA1; CYH; CYM; mast cell; Mast cell chymase 1; mast cell protease 3; Mast cell protease 5; mast cell protease I; Mast cell protease III; MCP3P; Mcp5; Mcp-5; Mcpt3; Mcpt5; MCT1; mMCP-5; rMCP-3; rMCP-5; rMCP-III
• Common Name: Mast Cell Chymase
• Gene Symbol: CMA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining