Invitrogen™ Human MASP1 (aa 241-361) Control Fragment Recombinant Protein

Product Code. 30196087

Brand: Invitrogen™ RP100526

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81958 (PA5-81958. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MBL is a key component in immune response in that it can directly trigger neutralization of invading microorganisms by an Ab-independent mechanism. Mutations of human MBL are associated with immunodeficiency resulting from a reduction in the ability of the mutant MBL to initiate complement fixation. In human, three types of MBL-associated serine proteases, MASP-1, MASP-2 and MASP-3, and a truncated form of MASP-2 (small MBL-associated protein; sMAP or MAp19) complex with MBL to activate the lectin pathway of the complement system. MASP-3 is an alternatively spliced product from the MASP-1 gene. The heavy/A chains are identical between MASP-1 and MASP-3 but the light/B chains are entirely different. Activated MASPs subsequently cleave and activate downstream components of the complement pathway.

Specifications

• Accession Number: P48740
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5648
• Name: Human MASP1 (aa 241-361) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3 MC1; AW048060; C4/C2 activating component of Ra-reactive factor; CCPII; Complement factor MASP-3; complement-activating component of Ra-reactive factor; Crarf; CRARF1; mannan binding lectin serine peptidase 1; mannan-binding; mannan-binding lectin serine peptidase 1; mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor); mannan-binding lectin serine protease 1; Mannan-binding lectin serine protease 1 heavy chain; Mannan-binding lectin serine protease 1 light chain; Mannose-binding lectin-associated serine protease 1; mannose-binding protein associated serine protease-1; mannose-binding protein-associated serine protease; MAP1; MAp44; MASP; MASP1; MASP-1; Masp1/3; MASP3; PRSS5; Ra-reactive factor serine protease p100; raRF; Serine protease 5; serine protease MASP1
• Common Name: MASP1
• Gene Symbol: MASP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining