missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MARVELD2 (aa 444-554) Control Fragment Recombinant Protein

Product Code. 30207279
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207279

Brand: Invitrogen™ RP91256

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tight junctions form an important barrier of paracellular transport in epithelial cells. Sealing of two adjacent cells at bicellular tight junctions, a point where three adjacent cells are in contact with each other. Tricellulin is the first protein identified that specifically concentrates in tricellular tight junctions. This protein has four membrane spanning domains, similarly to claudins. Tricellulin expression is high in epithelium-derived tissues, such as small intestine, kidney and lung. Functional evidence for the role of tricellulin in tight junction formation comes from siRNA studies, where suppression of its expression leads to compromised epithelial barrier and tight junction formation. Loss of function in tricellulin mutants missing all or most of a conserved region in the cytosolic domain which binds to the cytosolic scaffolding protein ZO-1, indicate that interaction with other known tight junction proteins plays an important role for the function of tricellulin.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N4S9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 153562
Name Human MARVELD2 (aa 444-554) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC003296; DFNB49; MARVD2; MARVEL (membrane-associating) domain containing 2; MARVEL domain containing 2; MARVEL domain-containing protein 2; Marveld2; Mrvldc2; Tric; Trica; Tricb; Tricc; Tricellulin
Common Name MARVELD2
Gene Symbol MARVELD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.