missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202877

Invitrogen™ Human MARK3 (aa 399-548) Control Fragment Recombinant Protein

Product Code. 30202877
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202877

Brand: Invitrogen™ RP89020

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82890 (PA5-82890. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MARK3 is a member of a group of kinases known to regulate cell polarity via phosphorylation of microtubule-associated proteins (MAPs). The protein encoded by MARK3 is activated by phosphorylation and in turn is involved in the phosphorylation of tau proteins MAP2 and MAP4. Several transcript variants encoding different isoforms have been found for MARK3.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P27448
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4140
Name Human MARK3 (aa 399-548) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1600015G02Rik; A430080F22Rik; cdc25C-associated protein kinase 1; cTAK1; C-TAK1; ELKL motif kinase 2; Emk2; EMK-2; EMK2/MARK3 serine-threonine protein kinase; ETK1; ETK-1; KP78; MAP/microtubule affinity regulating kinase 3; MAP/microtubule affinity-regulating kinase 3; MARK3; microtubule affinity regulating kinase 3; Mpk10; MPK-10; PAR1A; Par-1 A; Protein kinase STK10; ser/Thr protein kinase PAR-1; Serine/threonine-protein kinase p78
Common Name MARK3
Gene Symbol MARK3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QSPHHKVQRSVSSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.