missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194422

Invitrogen™ Human MARK2 (aa 545-612) Control Fragment Recombinant Protein

Product Code. 30194422
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194422

Brand: Invitrogen™ RP95228

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MARK2 is a serine/threonine protein kinase involved in the control of cell polarity and microtubule stability. Several cDNA clones have been isolated that encoded two isoforms of the human ser/thr protein kinase EMK1. These isoforms were characterized by the presence of a 162-bp alternative exon that gave rise to two forms, one containing the exon and the other one lacking it. Both forms were found to be coexpressed in a number of selected cell lines and tissue samples. The human EMK1 was shown to be encoded by a single mRNA ubiquitously expressed.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7KZI7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2011
Name Human MARK2 (aa 545-612) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ELKL motif kinase; ELKL motif kinase 1; Emk; EMK1; EMK-1; MAP/microtubule affinity regulating kinase 2; MAP/microtubule affinity-regulating kinase 2; MARK2; mark2 {ECO:0000312; MGC99619; microtubule affinity regulating kinase 2; OTTHUMP00000218338; OTTHUMP00000218339; OTTHUMP00000218340; OTTHUMP00000218343; Par-1; PAR1 homolog; PAR1 homolog b; Par1b; Par-1 b; RGD:708483}; Ser/Thr protein kinase PAR-1 B; serine/threonine kinase; serine/threonine protein kinase EMK; serine/threonine-protein kinase MARK2; testicular tissue protein Li 117
Common Name MARK2
Gene Symbol MARK2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.