Invitrogen™ Human MARCH8 Control Fragment Recombinant Protein

Product Code. 30205550

Brand: Invitrogen™ RP91020

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82509 (PA5-82509. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MARCH8 (c-MIR) is a novel E3 ubiquitin ligase designated as the modulator of immune recognition (MIR) family, whose catalytic domain is a variant RING domain (RING-CH domain). MARCH8 was found as a functional and structural homolog of KSHV MIR1 and MIR2. MARCH8 targets B7-2 to lysosomal degradation and down-regulates the B7-2 surface expression through ubiquitination of its cytoplasmic tail. Furthermore, MARCH8 has been shown to down-regulate the expression of transferrin receptor and Fas, an important molecule for the induction of apoptosis. MARCH8 is the first example of an E3 ubiquitin ligase that is capable of inhibiting MHC II expression. Recent findings suggest that MARCH8 may regulate immune responses by promoting ubiquitination of MHC-II and CD86, leading to their subsequent endocytosis and lysosomal degradation.

Specifications

• Accession Number: Q5T0T0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 220972
• Name: Human MARCH8 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300017E09Rik; cellular modulator of immune recognition; cellular modulator of immune recognition (c-MIR); CMIR; c-MIR; c-mir, cellular modulator of immune recognition; E3 ubiquitin-protein ligase MARCH8; E3 ubiquitin-protein ligase MARCHF8; E3 ubiquitin-protein ligase MARCH8; March8; MARCHF8; MARCH-VIII; membrane associated ring finger 8; membrane associated ring-CH-type finger 8; membrane-associated ring finger (C3HC4) 8; membrane-associated ring finger (C3HC4) 8, E3 ubiquitin protein ligase; membrane-associated RING finger protein 8; Membrane-associated RING-CH protein VIII; MIR; RING finger protein 178; RING-type E3 ubiquitin transferase MARCH8; RING-type E3 ubiquitin transferase MARCHF8; RNF178; RP11-67C2.1
• Common Name: MARCH8
• Gene Symbol: MARCH8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGHGICHSDTNSSCCTEPEDTGAEIIHV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining