Invitrogen™ Human MARCH3 (aa 204-253) Control Fragment Recombinant Protein

Product Code. 30180933

Brand: Invitrogen™ RP99910

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60351 (PA5-60351. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the membrane-associated RING-CH (MARCH) family. The encoded protein is an E3 ubiquitin-protein ligase that may be involved in regulation of the endosomal transport pathway. [provided by RefSeq, Mar 2013].

Specifications

• Accession Number: Q86UD3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 115123
• Name: Human MARCH3 (aa 204-253) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330411I15Rik; A530081L18Rik; AI843639; E3 ubiquitin-protein ligase MARCH3; MARCH3; MARCH-III; membrane associated ring finger 3; membrane associated ring-CH-type finger 3; membrane-associated ring finger (C3HC4) 3; membrane-associated ring finger (C3HC4) 3, E3 ubiquitin protein ligase; membrane-associated RING finger protein 3; Membrane-associated RING-CH protein III; RING finger protein 173; RING-type E3 ubiquitin transferase MARCH3; RNF173
• Common Name: MARCH3
• Gene Symbol: MARCH3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FRYHCRLYNEWRRTNQRVILLIPKSVNVPSNQPSLLGLHSVKRNSKETVV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining