Invitrogen™ Human MARCH1 (aa 220-282) Control Fragment Recombinant Protein

Product Code. 30203418

Brand: Invitrogen™ RP90986

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53199 (PA5-53199. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

E3 ubiquitin-protein ligase that mediates ubiquitination of TFRC, CD86, FAS and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. By constitutively ubiquitinating MHC class II proteins in immature dendritic cells, down-regulates their cell surface localization thus sequestering them in the intracellular endosomal system.

Specifications

• Accession Number: Q8TCQ1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55016
• Name: Human MARCH1 (aa 220-282) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1-Mar; 2900024D24Rik; BB085186; E3 ubiquitin-protein ligase MARCH1; MARCH1; MARCHF1; MARCH-I; membrane associated ring finger 1; membrane associated ring-CH-type finger 1; membrane-associated ring finger (C3HC4) 1; membrane-associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase; membrane-associated RING finger protein 1; Membrane-associated RING-CH protein I; RGD1305148; RING finger protein 171; RING-type E3 ubiquitin transferase MARCH1; RNF171
• Common Name: MARCH1
• Gene Symbol: MARCH1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining