Invitrogen™ Human MAPRE3 (aa 119-231) Control Fragment Recombinant Protein

Product Code. 30198362

Brand: Invitrogen™ RP89599

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82383 (PA5-82383. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EB3 is a 282 amino acid homologue of EB1, a protein known to bind APC (adenomatous polyposis coli). It has been shown to bind to tubulin in vitro and microtubules in vivo. Northern blotting shows expressions to be mainly in brain, and to a lesser degree in muscle. EB3 interacts with APCL, a homologue of the tumor suppressor APC, and this interaction may be involved in the stabilization or extension of microtubules.

Specifications

• Accession Number: Q9UPY8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22924
• Name: Human MAPRE3 (aa 119-231) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI790651; APC binding protein; EB1 protein family member 3; EB2; EB3; EBF3; EBF3-S; End-binding protein 3; Mapre3; microtubule associated protein RP/EB family member 3; microtubule-associated protein RP/EB family member 3; microtubule-associated protein, RP/EB family, member 3; RP3
• Common Name: MAPRE3
• Gene Symbol: MAPRE3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining