Invitrogen™ Human MAPRE2 (aa 228-291) Control Fragment Recombinant Protein

Product Code. 30198806

Brand: Invitrogen™ RP92427

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53483 (PA5-53483. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. The function of this protein is unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. This gene may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR. Alternative splicing results in multiple transcript variants.

Spezifikation

• Accession Number: Q15555
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10982
• Name: Human MAPRE2 (aa 228-291) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI314113; APC-binding protein EB1; APC-binding protein EB2; C820009F03Rik; CSCSC2; D18Abb1e; EB1; EB2; End-binding protein 2; Mapre2; microtubule associated protein RP/EB family member 2; microtubule-associated protein RP/EB family member 2; microtubule-associated protein, RP/EB family, member 2; RP1; T-cell activation protein, EB1 family; T-cell activation protein, EB1 family, member 2
• Common Name: MAPRE2
• Gene Symbol: MAPRE2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining